Protein Info for Echvi_1031 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 TIGR00416: DNA repair protein RadA" amino acids 1 to 451 (451 residues), 610.8 bits, see alignment E=7.4e-188 PF18073: Rubredoxin_2" amino acids 8 to 34 (27 residues), 43.8 bits, see alignment (E = 7.4e-15) PF13481: AAA_25" amino acids 79 to 222 (144 residues), 60.4 bits, see alignment E=8.5e-20 PF06745: ATPase" amino acids 81 to 142 (62 residues), 31.8 bits, see alignment E=4.5e-11 PF07728: AAA_5" amino acids 97 to 184 (88 residues), 23.1 bits, see alignment E=3e-08 PF00004: AAA" amino acids 97 to 217 (121 residues), 30 bits, see alignment E=3e-10 PF13541: ChlI" amino acids 346 to 428 (83 residues), 37.8 bits, see alignment E=7.5e-13 PF05362: Lon_C" amino acids 353 to 451 (99 residues), 26.3 bits, see alignment E=2.3e-09

Best Hits

Swiss-Prot: 52% identical to RADA_STRR6: DNA repair protein RadA (radA) from Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 70% identity to chu:CHU_3614)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVG4 at UniProt or InterPro

Protein Sequence (458 amino acids)

>Echvi_1031 DNA repair protein RadA (Echinicola vietnamensis KMM 6221, DSM 17526)
MPKIKTAYFCQNCGAQSPKWVGKCPACGEWNTYVEEVIHKEETGRGSWKQGSEKNTRHNS
PRKLQEINYEEHPRLVTADAELDRVLGGGIVPGSLTLIGGEPGIGKSTLMLQIALVLHQT
KVLYVSGEESESQIKMRADRMQYHSENCFVLSETNTQVIFQQIEALKPDVLVIDSIQTLH
SKHVESAAGSVSQVRECTAELMKFAKETGTPVFLIGHITKDGSIAGPKILEHMVDTVLQF
EGDRHLSYRILRTSKNRFGSTNELGIYEMRADGLRGVANPSEILLSQREEVLNGVAIGAM
LEGNRPLLIEIQSLISPATYGTPQRSSTGHDAKRLNMLLAVLEKRGGMRLGQQDVFLNVA
GGMRVDDPGLDLAVCAALLSSYEDTPVSPDLCFAGEVGLGGEIRAVNRIENRIAEADKLG
FKKIIVSKYAVKGVDLSTFNIEVIPVTKLEEMYQRLFH