Protein Info for Echvi_1021 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted dehydrogenases and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 50 to 175 (126 residues), 65.6 bits, see alignment E=1e-21 PF19051: GFO_IDH_MocA_C2" amino acids 216 to 430 (215 residues), 74.2 bits, see alignment E=1.9e-24

Best Hits

KEGG orthology group: None (inferred from 45% identity to sli:Slin_4997)

Predicted SEED Role

"Myo-inositol 2-dehydrogenase (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVF5 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Echvi_1021 Predicted dehydrogenases and related proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MDKNTKAGLSRRKFMGSSALSALGLSFLPHLGLGKSQEPSFSPLGISTVRLGFIGLGRQS
YGIMQGMMNIPHVEIIAGCDVYGVKRERFQQTVSARYGKSPADIPVYERYQDLLAREDVD
AVVIATPDFWHALMAIDACKAKKDVYLEKPLTYTIKEGQALVKAVRDNSVVLAVGSQQRS
EHNFQYAVRMVQKGHIGKVKQVKANVGTPTSPKPFDLSKEEVPSDLNWDLWLGPIKPVPY
NHELNPPITVDPVQHEQLWAAWRWYWETGGGLMTDWGAHMFDIGQWGIGMDRHGPVEIRP
EKENEPLTFIYENGIVMTAEPFDGDTRGVRFIGDKGWIQVSRGGFKASDPELVVPEAKKS
NVDAHPHYLDFIESVIRRKDPIASVEIGHSTCTVCTLGNIANKLGRQLRWNPAKQTFGQD
AAAEELLHYDYENGYSLKT