Protein Info for Echvi_0960 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 869 PF01624: MutS_I" amino acids 12 to 119 (108 residues), 131.9 bits, see alignment E=3e-42 TIGR01070: DNA mismatch repair protein MutS" amino acids 12 to 866 (855 residues), 927.5 bits, see alignment E=4.5e-283 PF05188: MutS_II" amino acids 132 to 257 (126 residues), 83 bits, see alignment E=6.7e-27 PF05192: MutS_III" amino acids 275 to 563 (289 residues), 142.1 bits, see alignment E=7.2e-45 PF05190: MutS_IV" amino acids 432 to 523 (92 residues), 100 bits, see alignment E=1.8e-32 PF00488: MutS_V" amino acids 617 to 806 (190 residues), 277.6 bits, see alignment E=1.5e-86

Best Hits

Swiss-Prot: 69% identical to MUTS_CYTH3: DNA mismatch repair protein MutS (mutS) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 72% identity to mtt:Ftrac_2299)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW19 at UniProt or InterPro

Protein Sequence (869 amino acids)

>Echvi_0960 DNA mismatch repair protein MutS (Echinicola vietnamensis KMM 6221, DSM 17526)
MAKAKAKAAKETPLMKQYNSIKAKHPGALLLFRVGDFYETFGEDAVTASKVLDIVLTKRA
NGAASHIELAGFPHHSLDSYLPKLVRAGNRVAICDQLEDPKEVKGIVKRGVTELVTPGLS
FNDNVLDKRRNNYLASIYFGKQDLGIAFLDLSTGEFMCAEGNASYIEKLLQSFSPSEIIY
SKADKTKAAELLKDDFTTFHCEDWVFQYDYTYEKLTDHFQTANLKGFGIETLEHGIIAAG
AVLYYLEETEHKEVKHIAAISRIAEEKFVWLDKFTIRNLELVYPQQDGGVPLIQILDQTV
TPMGSRMMKKWMVLPLKEKAPIEERLKVVDHFHAEQELAEEILSHLKHIGDLERIISKVA
VARINPREMNQLKKALKSTLPIKELLKKQKNPSLKKLGDQINACEFLLEKIDKELKEDAP
MLTHQGNIICDGVDAELDEYRKLSTSGKDYLVQIQQREIQRTGISSLKIAYNKVFGYYLE
VSNTHKDKVPAEWIRKQTLVNAERYITEELKEYEDKILHAEEKLVVLEHKYFNLLVQSAG
EYVTQIQENARILATVDCLLSFASVAARNGYCRPKVADTDTLEIKDGRHPVIEKQLPVGE
DYVPNDIYLDNSTQQIIIITGPNMAGKSALLRQTALIVLMAQMGSFVPASYARIGIIDKV
FTRVGASDNLSKGESTFMVEMTETASILNNLSDRSLVLMDEIGRGTSTYDGISIAWSIVE
FLHNHPKFNAKTLFATHYHELNQLAEDFPKVKNFNVSVKEVADKVIFMRKLKEGGSEHSF
GIHVAQMAGMPNPVVLRAAEIMGHLEKDKDMHQQQEKMKDVPKNNFQLSLFEIDPKFKEA
QELLDSIDINTISPVEALLKLNEIKKKLD