Protein Info for Echvi_0953 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Periplasmic protein involved in polysaccharide export

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 869 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 844 to 859 (16 residues), see Phobius details PF02563: Poly_export" amino acids 158 to 226 (69 residues), 46 bits, see alignment E=7.3e-16 PF22461: SLBB_2" amino acids 245 to 322 (78 residues), 30.5 bits, see alignment E=4.7e-11 amino acids 503 to 584 (82 residues), 32.4 bits, see alignment E=1.2e-11 PF10531: SLBB" amino acids 245 to 292 (48 residues), 30.9 bits, see alignment 3e-11 amino acids 328 to 377 (50 residues), 51.1 bits, see alignment 1.5e-17 amino acids 411 to 456 (46 residues), 23.5 bits, see alignment 5.9e-09 amino acids 502 to 550 (49 residues), 52.5 bits, see alignment 5.4e-18 amino acids 595 to 641 (47 residues), 19.3 bits, see alignment 1.3e-07

Best Hits

Predicted SEED Role

"putative polysialic acid transport protein" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWU1 at UniProt or InterPro

Protein Sequence (869 amino acids)

>Echvi_0953 Periplasmic protein involved in polysaccharide export (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKFLNLVLVQAMMGLALLLAIPQEAAAQSISDVASIKVDELSDDQVKALVKKAQDAGLG
KEALLEMARSRGMAEAEVEKLSDRIEEVAMDSAPARSSSSLSKREPRQQKDYTEIQQGTI
AHQGPAAEEKNNPSYFGLDLFYQKERELTFEPNLNMATPSSYVLGPGDLLYVDVYGASEN
YYESTITPEGNLILENIGPIGLSGLSISEATKVVKNRLSRFYADMQGDNPSTFMQLSLGN
VRSIKVHLVGELRLPGTFTLSAFSTVFNALYAAGGPNTNGTMRNIKVFRNNQQVATVDAY
DFLVNGKANMGFQLQDQDVIMVEPYASRVTLRGAVKRPMTFEVQPGETFEDVLAFAGGFT
DNAYTNKVSVTRFTQKEKTVSDIYNGQFGIFTVKAGDEYTIGTVLNRYNNRVQLKGAVFR
AGNYALSEGLTLSQLITRADGLRGDAYLDRASILRTHEDLSTSVIPVNLKAVMAGDQDVS
LEADDIIRISSIYDLKDEYYLKISGEVRDPGIYPYSEGMTAEDLIQQAGGFTESASRQDV
EIARRIQDGRENGEIAELIPVNLQDGLAIDGNAISLKPYDNLIVRRKPNFALERIVQVQG
QVNAPGEFALRDTEERISDVIGRAGGLTGYAYPAGATLIRRTEYFNTESEQYRRQKHLEK
LLDRIISQDPSEAQARQMDRLAQETKRGMTEEERRSLIAQSREETLHDISQGEGTSIKIK
ETEAIAIDLEAIMEQPGSKFDLILEEGDIISVPKQLQTVRMRGDVIYPTTVRYENGRSMK
YYIDRAGGFDSRAKRKRTYVVYANGEVARTKSFLGLKSYPKVAPGSEVIVPSKGPRVPLR
IGEIIGLTSGLATLALVISQINFNNGSGN