Protein Info for Echvi_0940 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 20 to 172 (153 residues), 34.2 bits, E=6.5e-12
• PF09314: DUF1972
  • amino acids 116 to 177 (62 residues), 34.2 bits, E=4.8e-12
• PF00534: Glycos_transf_1
  • amino acids 188 to 347 (160 residues), 59.5 bits, E=7.8e-20
• PF13692: Glyco_trans_1_4
  • amino acids 199 to 328 (130 residues), 42.3 bits, E=2.4e-14

Best Hits

KEGG orthology group: None (inferred from 35% identity to geb:GM18_2243)

Predicted SEED Role

"Alpha-D-GlcNAc alpha-1,2-L-rhamnosyltransferase (EC 2.4.1.-)" in subsystem Rhamnose containing glycans (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See L0FW00 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Echvi_0940 Glycosyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MQNKPLHVAIFGAKGYPYVYGGYDTMVKELCERLVKKNVRVTVYCHRSLFKERPPQVNGI
DLVYMPAIESKSFTQLTHSFFCMIHACFSSADVIFVVNSGNGPFGLISRMMRKPTAINVD
GLEWLRPKWKGIGGKYFYWASKMATKFYDQLINDSDEMQRVYQELFQAPSKVIAYGSNPG
LQADPALIQKWQLEKEGYYLIVGRLIPDNNADLIIEGFTKSASKRKLVVVGDVPYKDEFA
ERLKNIPDDRLLFTGYVKDQQELAALYRNCYAYFHGHEYGGTNPAMLKALGYDCAILALD
TPFNQEMLQQGKHGWYFQKDTEDIVAVVEKAESSPEAMLQLRQTSRQGLTQKYDWDHVTE
QYLEVFRQLAGR