Protein Info for Echvi_0885 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosphoribosylaminoimidazole carboxylase, PurE protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00731: AIRC
  • amino acids 4 to 151 (148 residues), 218.5 bits, E=1.4e-69
• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 5 to 159 (155 residues), 212.6 bits, E=1e-67

Best Hits

Swiss-Prot: 60% identical to PURE_THEMA: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 72% identity to mtt:Ftrac_2582)

MetaCyc: 48% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

See L0FVV3 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Echvi_0885 phosphoribosylaminoimidazole carboxylase, PurE protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKQVGIIMGSKSDLPIMSEAAKALEELGVQYELTIVSAHRTPRRMIDYAESARQRGIKV
IIAGAGGAAHLPGMVASLTSLPVIGVPIKSSNSIDGWDSILSILQMPAGIPVATVALNGA
KNAGILAASMVGAYDAKVAENMENFKKELREKVEETARDVELKGWKDTLDD