Protein Info for Echvi_0882 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Mismatch repair ATPase (MutS family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details PF00488: MutS_V" amino acids 426 to 583 (158 residues), 89.2 bits, see alignment E=1.7e-29

Best Hits

Predicted SEED Role

"MutS-related protein, family 1" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWY3 at UniProt or InterPro

Protein Sequence (599 amino acids)

>Echvi_0882 Mismatch repair ATPase (MutS family) (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKPVLHFILYLGMKLDLHTTNTSQELRTCKRKIASLALARMILFLGIVALTIIGLTEVR
WFLFFFFPMAGLFIYLILLFNLQKDRQAFLQAVANMEDERQRRKERQLADFDGGEAFKDK
KHPFSNDLDLFGEHSLFQLINHTTGDGGRKLLAQWMKAPIDPEKAQQRYTAIKELSTHAD
FIKKFEATGKAFVKEEKSKKPFYDWLKMPNAWRTFYWLPFIAGPIGGIAFLGGWLYLDWP
VAYLLIWMLAGTALLGLIFQPLLVAFKNMPDEGDLKTYSIWAQELEQLDFQDPYLKSLQS
PVLEGDYRASAALKSLEQRSFMVQNRANMMYMIFDLLFLVDFGVLFSLEQWKQKHASKVQ
RWEEAFQEWQVLVSLAAFTREEALNCPVSWSDKMILNVSGLKHPLLSPSVCVGNDFNLSS
EKQTVLLTGSNMSGKTTFMRTVGINMVLANLGLSPFAKSYESGTFWLFTSMRNTDNLGES
VSSFYAELARIKRLLDQAEKQQPVFYLLDEILKGTNTTDRVMGSEALIRQLADSHSKGII
STHDIELAELSDKIPSLVNYSFHSDIKDNEILFDYKIKNGPCPSFNAHKLMELMGIRFQ