Protein Info for Echvi_0870 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00977: His_biosynth
  • amino acids 3 to 233 (231 residues), 194.1 bits, E=1.2e-61

Best Hits

Swiss-Prot: 46% identical to HIS4_BACTN: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 46% identity to bth:BT_1379)

MetaCyc: 31% identical to 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (Escherichia coli K-12 substr. MG1655)
isomerase. [EC: 5.3.1.16]

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.16

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

See L0FVU4 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Echvi_0870 Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MFEIIPSIWIINGKCVRLKKGDFTTEQVISDNPLEIAQEFENCGIERIHLVDLDGARRGS
PKNYHILHTISAYTSLIVDFTGGVGTDGDIIKVFEHGAKTITAATVAANSPEKFSQWLIS
YGREKINMAADTDPKDHLIKIKGWQKNTDIHLYDQISYFYDRGLKYLKCSDITREGVMEG
PNFKLYEEIIARFPNLHLVASGGVRNVDDFKRLKELGLRGVVFGKAYYSGNITAEELKTF
VASCKAPI