Protein Info for Echvi_0858 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: pantothenate kinase, type III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K03525, type III pantothenate kinase [EC: 2.7.1.33] (inferred from 49% identity to dfe:Dfer_5203)

Predicted SEED Role

"Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
phosphopantothenate biosynthesis I (4/4 steps found)
phosphopantothenate biosynthesis II (1/3 steps found)
superpathway of coenzyme A biosynthesis II (plants) (5/10 steps found)

KEGG Metabolic Maps

Pantothenate and CoA biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.33

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWK2 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Echvi_0858 pantothenate kinase, type III (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNLVIDIGNTRIKAALFHGEEQIEDCVETHLDELLLKVGLWEFDQVMVSSVRWSQEELE
VMLPFGFLFLDRSVPLPVTNGYETPHTLGLDRIAAAIGAQGMAHGGPVLSIDLGTCITYD
FIDDTHRYLGGAISPGVEMRFKAMHAQTAKLPLLEHIPSAEFPDLIGNNTASGMKSGVYH
GVYFELEGAIARYQSHYQDLKVFICGGDAKFFESLTKDYIFVIPNLVLHGLNRILNYNVN
TN