Protein Info for Echvi_0853 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Hemolysins and related proteins containing CBS domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details PF01595: CNNM" amino acids 10 to 196 (187 residues), 115.4 bits, see alignment E=3.7e-37 PF00571: CBS" amino acids 225 to 274 (50 residues), 17.8 bits, see alignment 5.1e-07 amino acids 281 to 334 (54 residues), 28.3 bits, see alignment 2.7e-10 PF03471: CorC_HlyC" amino acids 350 to 425 (76 residues), 82.4 bits, see alignment E=2.9e-27

Best Hits

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWJ6 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Echvi_0853 Hemolysins and related proteins containing CBS domains (Echinicola vietnamensis KMM 6221, DSM 17526)
MEYQYLVYVLITLMFSALFSGLEIAFVSANKLHIELQNKQGDFTGKVLAGFMKNPGQFIG
TTLLGNTVSLVVYGIFMAYLLEPAIAHFLQFLPDGLHGLNNQVTVMLIQTVLSTLIVLIT
AEFIPKSIFMLNPNNLLSFFAIPFMIIYYTMYPIVWLVVGMSRFFITRILGLDYSEDKPV
FKITDLNSFIQNNLETEGDDATDIDTKIFDNAVEFKKVKARDCMVPRTDIVAVDVEDSIE
DLKSTFMESGHSKIIVYKENIDDVIGYCHHLELFKKPKEVNDILTPIIIVPETALVNELL
VQFISERKSLALVVDEFGGTSGIVSMEDIIEEIFGEIEDEYDNDDLIEQELSDDEYLLSA
RHEIDYLNEKYDWNLPEGDYDTLSGFILSLTENIPKKGESAVYGPFTFTVVSKQEHRIDT
VKLKINT