Protein Info for Echvi_0839 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 73 to 99 (27 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details PF07947: YhhN" amino acids 31 to 220 (190 residues), 139.5 bits, see alignment E=4.9e-45

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUZ2 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Echvi_0839 Predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MKQKGIGWLYLYLFAGVSDMVMIVEGHPEYRYYTKPLIMLSLAIYFLTTTAVIKNSLLRK
SVGAGLIFGLAGDVLLLFPSLFLYGLGAFLITLICYTIAFKLTQNHQINLRNINFLKTFF
YNLPLYIFAAMLYFLVNDHLGQMKVPVVLYILAMVLMVSIARERFKRTNMLSFIQVFIGA
LLFMISDSILALDLFFSPIANADILIMGTYILAQLLIVMGIRSHLVHSPTAK