Protein Info for Echvi_0830 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 131 to 147 (17 residues), see Phobius details amino acids 153 to 183 (31 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details PF13231: PMT_2" amino acids 54 to 212 (159 residues), 86.3 bits, see alignment E=2.7e-28 PF02366: PMT" amino acids 72 to 217 (146 residues), 36.3 bits, see alignment E=4.7e-13

Best Hits

KEGG orthology group: None (inferred from 34% identity to saf:SULAZ_1666)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVR3 at UniProt or InterPro

Protein Sequence (503 amino acids)

>Echvi_0830 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family (Echinicola vietnamensis KMM 6221, DSM 17526)
MKDTKQLRIYLIAVLAIVSFFKILFTATTSLSLFSEETQYWLWSQNLDWNYYSKPLMIAV
YNFIFTGILGNTDVAVRLSAVLFSAGTAWVIFELGQQMYRDPRIGFWAALMLIVMPYFHL
ASFFHTTDSSLLFFWALSFYWLYRATVSQKTSYWVYAGLASAMGMLSKNTMVLAIPLIFL
YLLLVDFKQLKQKGFYVYCLVFSLSFIPIIIWNFQHDFVTFRHVGTLGGVEGESEPFDMG
ESLKYISEYVGGQLGIISAFFIPFMVMAIRRLVKYKERKMLFNLLPAILVWMMFFLISIT
KRVEVNWPAFAYVTLPIAMAYVLTLVGQGWKKYATYATAISGILLILIMKPAPLDAIGFR
KVLRPDKDPLARLAGYREMGARIDFLVDSLQLQKHFIFSDSYHLASEMAFYVEGNPQTYT
INLGRRKNQFDHWPGIDQFENQQYDGVFVQWNTADRPKVIAGFDKRILKETHYATYRGDT
VRVFSIEIYQNLHHIDEVKTDSY