Protein Info for Echvi_0829 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Membrane-associated phospholipid phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details PF01569: PAP2" amino acids 80 to 198 (119 residues), 76.2 bits, see alignment E=1e-25

Best Hits

KEGG orthology group: None (inferred from 42% identity to cts:Ctha_0665)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUY4 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Echvi_0829 Membrane-associated phospholipid phosphatase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKKSIPDVYLFFYFLTFIIGGIVLLNVPKGDYELFINRHHFLLADLFFSFITHAGDGLI
FLAVFPILLYYRFAHGILCVFNAAIHMVLSVILKRLVFVHSPRPAEFFKDIDLVQVAGVP
MHHWHSFPSGHTATAFALMTMLAMLYPKRHRLQLGFLLVAVLIGFSRVYLMQHFILDVMA
GSVLGVGSAFAARTIVRTYFKGKTYKKGLLKKKKVALSELKPGYQPLRIRIKPWKWPF