Protein Info for Echvi_0825 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Holliday junction DNA helicase, RuvB subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF05496: RuvB_N" amino acids 24 to 182 (159 residues), 255.1 bits, see alignment E=6.9e-80 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 28 to 330 (303 residues), 462.6 bits, see alignment E=2.5e-143 PF07728: AAA_5" amino acids 58 to 176 (119 residues), 28.2 bits, see alignment E=5.3e-10 PF00004: AAA" amino acids 59 to 182 (124 residues), 70.4 bits, see alignment E=6.4e-23 PF17864: AAA_lid_4" amino acids 185 to 258 (74 residues), 100.2 bits, see alignment E=1.3e-32 PF05491: RuvB_C" amino acids 259 to 330 (72 residues), 92.4 bits, see alignment E=4.1e-30

Best Hits

Swiss-Prot: 79% identical to RUVB_CYTH3: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 83% identity to mtt:Ftrac_3352)

MetaCyc: 58% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVQ8 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Echvi_0825 Holliday junction DNA helicase, RuvB subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MREDYLKGDDEHMSQTDKDFEKALRPLSFDDFTGQQKIVDNIQVFVMAAKKRGESLDHVL
LHGPPGLGKTTLSHIIANELESSLKITSGPVLDKPSDLAGLLTNLEEGDVLFIDEIHRLN
AVVEEYLYSAMEDFRIDIMLDSGPNARSVQISLNPFTLIGATTRSGLLTSPLRARFGINA
RLEYYDAKLLTTIVTRSANILGAPIDEVAAYEIARRSRGTPRIANTLLRRTRDFADIKGN
GTITLDIAKVALDALDVDENGLDEMDNRILTTIIEKFKGGPVGISTIATACGEEGETIEE
VYEPFLIQEGYLKRTSRGRIATELAYKHLNIRPHFGGQSGSLFGE