Protein Info for Echvi_0815 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: GTP-binding protein Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00231: small GTP-binding protein domain" amino acids 9 to 167 (159 residues), 91.9 bits, see alignment E=3.9e-30 TIGR00436: GTP-binding protein Era" amino acids 9 to 277 (269 residues), 259.6 bits, see alignment E=3.1e-81 PF02421: FeoB_N" amino acids 11 to 167 (157 residues), 50.7 bits, see alignment E=6.2e-17 PF01926: MMR_HSR1" amino acids 11 to 124 (114 residues), 88.6 bits, see alignment E=1.3e-28 PF00071: Ras" amino acids 13 to 170 (158 residues), 27.1 bits, see alignment E=1.1e-09 PF10662: PduV-EutP" amino acids 13 to 166 (154 residues), 39.5 bits, see alignment E=2e-13 PF00009: GTP_EFTU" amino acids 36 to 172 (137 residues), 41.3 bits, see alignment E=5.2e-14 PF07650: KH_2" amino acids 207 to 283 (77 residues), 65.9 bits, see alignment E=9e-22

Best Hits

Swiss-Prot: 53% identical to ERA_AMOA5: GTPase Era (era) from Amoebophilus asiaticus (strain 5a2)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 63% identity to mtt:Ftrac_1699)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWT1 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Echvi_0815 GTP-binding protein Era (Echinicola vietnamensis KMM 6221, DSM 17526)
MTEKTHKAGFVNIIGKPNVGKSTLMNVLVGERLSIISSKAQTTRHRILGLMNGDDYQIVF
SDTPGMLKPKYELHKSMMSFVNLSLEDADVIVFVTDLYETDNEIEEVIEKINHAGAPVLL
VINKIDLSKENKLEEVTQYWTERIKADTVIPVSALENFNIERIMQEILDRLPVHPPYYDK
EELTDRPERFFASEIIREKIFTNYKKEIPYSTEVAIDQFTEDDKLIRIRAIIFVERSSQK
GIIIGDKGKAIKHVGIQSREALEAFFGKQVYLETHVKVEDDWRKNKNKLRKFGYDQ