Protein Info for Echvi_0814 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosome-associated GTPase EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 435 (432 residues), 523.9 bits, see alignment E=5.2e-161 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 91.9 bits, see alignment E=1.5e-29 amino acids 179 to 297 (119 residues), 88.3 bits, see alignment E=2e-28 TIGR00231: small GTP-binding protein domain" amino acids 5 to 132 (128 residues), 64.4 bits, see alignment E=1.6e-21 amino acids 177 to 327 (151 residues), 85.9 bits, see alignment E=3.9e-28 PF02421: FeoB_N" amino acids 5 to 159 (155 residues), 45.5 bits, see alignment E=3e-15 amino acids 179 to 338 (160 residues), 49.8 bits, see alignment E=1.4e-16 PF04548: AIG1" amino acids 6 to 108 (103 residues), 28.5 bits, see alignment E=4.8e-10 PF00009: GTP_EFTU" amino acids 254 to 348 (95 residues), 39.9 bits, see alignment E=1.7e-13 PF14714: KH_dom-like" amino acids 355 to 435 (81 residues), 102.4 bits, see alignment E=6.8e-33

Best Hits

Swiss-Prot: 62% identical to DER_CYTH3: GTPase Der (der) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03977, GTP-binding protein (inferred from 68% identity to mtt:Ftrac_1697)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FT65 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Echvi_0814 ribosome-associated GTPase EngA (Echinicola vietnamensis KMM 6221, DSM 17526)
MANIVAIVGRPNVGKSTFFNRLVEQRKAIEDNESGVTRDRHYGHAQWGGKFFSVIDTGGY
VTGSEDVFEAEIRKQVKLAVEEASAILFVVDCIDGLTDLDKEFANELRGTNKPIYIVANK
ADTQERAFMANEFYELGLGEGTVYPIAAASGSGTGDLLDELVTLFDDEGIENPDEGIPKI
AILGRPNVGKSSFLNALLGTERTIVTDEAGTTRDTINSYYTLYSKNFIISDTAGIRKKSR
VKEDIEFYSVMRSLRTLEDSDVVIVMVDATRGLESQDINLISLAIKNNKGVMIMVNKWDL
IEKDHKTMNKFKDDMMEKLGENRWIPIIFTSMLTKQRIFQAIELAVQVYENKTRKITTSQ
LNDKMLPEIERYPPPAWKGKYIKIKYITQLPTKNPVFAFFCNLPQYLKSPYTRYLENRIR
DHFDFQGVPIKITYKRK