Protein Info for Echvi_0784 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 5 to 588 (584 residues), 763.4 bits, see alignment E=1.6e-233 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 6 to 456 (451 residues), 570.5 bits, see alignment E=2.9e-175 PF00270: DEAD" amino acids 20 to 180 (161 residues), 92.2 bits, see alignment E=1.1e-29 PF00271: Helicase_C" amino acids 217 to 324 (108 residues), 69.7 bits, see alignment E=8.9e-23 PF16124: RecQ_Zn_bind" amino acids 335 to 397 (63 residues), 64.6 bits, see alignment E=4e-21 PF09382: RQC" amino acids 401 to 503 (103 residues), 93.8 bits, see alignment E=2.3e-30 PF00570: HRDC" amino acids 520 to 586 (67 residues), 69.1 bits, see alignment E=8.7e-23 PF11408: Helicase_Sgs1" amino acids 523 to 580 (58 residues), 24.8 bits, see alignment 6.3e-09 PF14493: HTH_40" amino acids 617 to 704 (88 residues), 75.9 bits, see alignment E=8.9e-25

Best Hits

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FT40 at UniProt or InterPro

Protein Sequence (708 amino acids)

>Echvi_0784 ATP-dependent DNA helicase RecQ (Echinicola vietnamensis KMM 6221, DSM 17526)
MITPKEVLKNFYGYDSFRGQQEAIIQSILKQQDTIVLMPTGGGKSVCYQIPAMVNDGLTL
VISPLIALMKDQVDALNGMGIPAAYLNSSQSASEQRFVSEEIRSGKLKLLYVAPERLFGG
AFPLTETLKTSRLSLVAIDEAHCVSQWGHDFRPDYLMIGRLRQELPDVPFVALTATADKQ
TRADIADKLGLRKPKWFISSFDRPNITYRIVPKRNSFEKLLDFLEYHQKNSGIIYCLSRK
NVEDMAGRLQAAGLSALPYHAGLDRQTRASHQEKFIKDKVKIMVATIAFGMGIDKSNVRF
VVHMNMPQNIEGYYQETGRAGRDGLPSDALLFYSYADVMTLQRMIDTPDNPDYSEVMLAK
LEKMKQFCQSNTCRRRYLLGYFDEEEQKDCGNCDRCLSKDNKQDMTVPAQMLLSTIVRLK
ENYGLGYCVLVLRGSKSAKVQEEHKALTVYGIGKEKSEDFWKKLGQHLQQEGYLAEAGTQ
FPTLKLTTIAWEKLKGKKKFLLQMGEGGFDHQPTTVAYEEGLFEELKRIRFGLAQKENVP
PYVIFSDNTLVEMAQYLPHDHDSFLQISGVGQRKAENYEDHFLPVIKSYAAEHLLKPKKK
LSARKPSKSASTGLSKTELVTLQYQRDGLNVFEIAKAREMSLTTIEGHIAKLVKLKKLEA
ETFLSKDDLLNIRLFYRRQEGSFLKPIKEHFGERYSYFQIKVAIAEEQ