Protein Info for Echvi_0781 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized membrane protein (homolog of Drosophila rhomboid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 50 to 75 (26 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 178 to 205 (28 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details PF01694: Rhomboid" amino acids 44 to 103 (60 residues), 52.2 bits, see alignment E=7.6e-18 amino acids 164 to 255 (92 residues), 48.7 bits, see alignment E=9e-17 PF08551: DUF1751" amino acids 44 to 108 (65 residues), 24.9 bits, see alignment E=2.6e-09

Best Hits

KEGG orthology group: None (inferred from 44% identity to sli:Slin_5568)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWE1 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Echvi_0781 Uncharacterized membrane protein (homolog of Drosophila rhomboid) (Echinicola vietnamensis KMM 6221, DSM 17526)
MFRSLTPVVKNLLLINVGLYVVASFLLPQLDGLFALYYIESKYFMPFQFLTYMFMHAGLW
HLISNMFGLFIFGPLLEQFLGPKKLLTLWMVCGVGAGVLYSGYTAFQMNQLNQKVETFYN
NPDPEVFNQFVSDNSYMFNNSVYDFIDKFSRDPSNETYVQNAKSIMNNIRDQKSNIPMVG
ASGALFGVLVAFGMLFPNTQLFLLFPPMPIKAKYLVLFYGLYTVYNIIVNNPTDNVAHFA
HFSGLIIGAILVTFWKKDRTSFY