Protein Info for Echvi_0765 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Carbon starvation protein, predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details amino acids 378 to 396 (19 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details amino acids 448 to 448 (1 residues), see Phobius details amino acids 451 to 472 (22 residues), see Phobius details amino acids 479 to 501 (23 residues), see Phobius details amino acids 508 to 529 (22 residues), see Phobius details PF02554: CstA" amino acids 6 to 354 (349 residues), 403.7 bits, see alignment E=7.6e-125 PF13722: CstA_5TM" amino acids 377 to 494 (118 residues), 125 bits, see alignment E=2.2e-40

Best Hits

KEGG orthology group: K06200, carbon starvation protein (inferred from 70% identity to mtt:Ftrac_2374)

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWN6 at UniProt or InterPro

Protein Sequence (544 amino acids)

>Echvi_0765 Carbon starvation protein, predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSLAPLLLLAAITLIAAYFIYGKFVFKKFDIRNSHVTPSHKYQDGVDYEPSRPIVVLGHH
FASIAGAGPIVGPIIAVTFGWIPAVIWILVGGIFFGAVHDLGSMVASLRSEGKSIGTIIK
QNIGQSGKQLFMLFSFSTLILVIAVFADIIAKTFINNPGVASASILFILLAIVFGLINKM
VAHRKSLFLLTSVVGVGLMYYFVYLGMQLPFELDYKVWLYVLLAYAFIASVTPVSLLLQP
RDYLNSFLLYGLIIFAVLGIFYANPDIKMDHQIHLASDNLGYLFPVLFVTIACGAISGFH
SLVASGTTSKQIDKEGDAKIVGFGGMLIESFLAIISVGAVIILSREEYTMALSAKGPVTM
FSDGLGAMMASLGIPEELAVSFVALTVSAFALTTLDTCTRLARFTFQEYFEGAKGPVGKT
FASNRYISTSIVVILSILLISSGGFTTLWPIFGSANQLLAALALLAVAVWLIKKNVNATF
VIIPMFFMFTVTLTSLGIFAWKNFQEKAYILTTIAGGLFILSVVLIILAKKSLASHAPLS
ASQN