Protein Info for Echvi_0761 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Arginase/agmatinase/formimionoglutamate hydrolase, arginase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF00491: Arginase" amino acids 57 to 295 (239 residues), 63.8 bits, see alignment E=9.4e-22

Best Hits

KEGG orthology group: K01479, formiminoglutamase [EC: 3.5.3.8] (inferred from 53% identity to chu:CHU_3062)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWC5 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Echvi_0761 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family (Echinicola vietnamensis KMM 6221, DSM 17526)
MDLKLFFDPIPESITQQQYAHNSFFKHINYHGELFPDLNGVQVAIIGLEESRGATDPISI
DTAVQEVRRKLFQLKRGLSHYKIADLGNLRNGVDLKETYIRIKTVGEELMQQQILPIFIG
GTHDLDVGQYLSYEGMKKLVSMLTVDAKIDMDDEGAPFEVHSQDIILHQPNFLFNYTQLA
YQSFLTDRDLVNVMEKLYFDHVRLGQLRDNFKEVEPLIRNADLLSFDICAIQSADAPGAC
DAQPFGLTAEEACQIAWFAGMNEKLSSIGIYGYQPSYDDRRFKTASVIATMVWYFIEGFY
HRKDSLSFKSNDYTKYTVSLDSKPSTIVFYKSKLSAKWWMEVPQTSKEKFERDTIIPCSY
QDYQTAQRGEVPDRWVNAQLKLF