Protein Info for Echvi_0752 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF08323: Glyco_transf_5" amino acids 2 to 220 (219 residues), 61.5 bits, see alignment E=3.1e-20 PF13579: Glyco_trans_4_4" amino acids 130 to 232 (103 residues), 55 bits, see alignment E=3.7e-18 PF13439: Glyco_transf_4" amino acids 136 to 234 (99 residues), 73.6 bits, see alignment E=6e-24 PF20706: GT4-conflict" amino acids 144 to 370 (227 residues), 58.5 bits, see alignment E=1.8e-19 PF00534: Glycos_transf_1" amino acids 246 to 388 (143 residues), 112.6 bits, see alignment E=4.7e-36 PF13692: Glyco_trans_1_4" amino acids 251 to 388 (138 residues), 96.1 bits, see alignment E=7e-31

Best Hits

Predicted SEED Role

"Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52)" in subsystem Teichoic and lipoteichoic acids biosynthesis (EC 2.4.1.52)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUR9 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Echvi_0752 Glycosyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKVLMFGWEFPPHISGGLGTACYGLLKGMSHFDHEVIFVVPKLYGDEDPLADFVNASDVE
IDYREQRFKQIWKNLTYLEVSSFLIPYLGPEEYARFTDKALHDRTDVDESIFANKFSFTG
KYTKDLIMEVSRYALVAGQIAKNKEHDIIHAHDWLSFPAGIAAKKISGKPLVVHVHATEF
DRSGEHVNQRVYDIERSGMEMADKIIAVSHLTKKTIISRYGIPEEKITVIHNAVLDTSII
TSTATKKVPEKIVTFLGRITFQKGPEYFIEAANKVLKKDDNVRFVMAGSGDLMNRMIDRV
AELRIATKFHFTGFLRGGDVDQMFAISDVYVMPSVSEPFGISPLEAVRYNTPVIISKQSG
VAEVLTNALKIDFWDIDAMADAIFALLHYGGISTMFRQCGSEELKKMKWEHVAEKIFALY
DKTLTVTHS