Protein Info for Echvi_0737 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF01209: Ubie_methyltran" amino acids 3 to 156 (154 residues), 35.6 bits, see alignment E=2.3e-12 PF01135: PCMT" amino acids 32 to 94 (63 residues), 30.2 bits, see alignment E=1.3e-10 PF13489: Methyltransf_23" amino acids 38 to 186 (149 residues), 32.2 bits, see alignment E=3e-11 PF13847: Methyltransf_31" amino acids 39 to 122 (84 residues), 37.5 bits, see alignment E=7e-13 PF13649: Methyltransf_25" amino acids 42 to 137 (96 residues), 44.6 bits, see alignment E=6.6e-15 PF08241: Methyltransf_11" amino acids 43 to 138 (96 residues), 28.1 bits, see alignment E=8.9e-10 PF08242: Methyltransf_12" amino acids 44 to 139 (96 residues), 36.4 bits, see alignment E=2.6e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVI6 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Echvi_0737 Methylase involved in ubiquinone/menaquinone biosynthesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKNLYDKVAFFYDQLAMVVLGKTHRESKFTFLEYVMAGDRVLYIGGGTGENLSLLAEKV
GAEGKVFFVEASQKMMSKAKGQLTAAQLDRVVFLHQTDFDLLPAQQFDWVITQYLLDVLG
DRQIDGLFKAINDRIKPSARWILVDFFDRPSMRWLQWMMIWFFRLVTANPRKNLPRYHQF
FQKHGWQQMEEMVFKAGWIKAVVLQKSSRQ