Protein Info for Echvi_0719 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF01479: S4" amino acids 149 to 193 (45 residues), 48.7 bits, see alignment 5.2e-17 PF00849: PseudoU_synth_2" amino acids 208 to 339 (132 residues), 82.8 bits, see alignment E=3.2e-27 TIGR00093: pseudouridine synthase" amino acids 212 to 370 (159 residues), 150 bits, see alignment E=2.5e-48

Best Hits

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase B (EC 4.2.1.70)" in subsystem Two cell division clusters relating to chromosome partitioning (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW76 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Echvi_0719 pseudouridine synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKHNRNNRDGKRQTGGSSSRPQKSSNFRSQGKPRRTDNRFGNADNDRGKNTNPDFSPLK
KYRKETSSPQQNDKENDTSYKTVYKGRGKDQKPVFGNERVSDPNTRFKSGKFKQNRFIKN
NRFEQEEKPEYNLKKVKPQLAKPTSSEIRLNKYIANAGICSRRDADKLIEKGEVKVNGEV
ITELGYRVLLTDKVVYKGKLINPEKPVYVLLNKPKDFITTTDDPMNRKTVMHLVSSACEE
RIFPVGRLDRNTTGLLLFTNDGELAAKLSHPAEKVRKIYQVTLDSPITKTHFEEIAEGLT
LEDGLVNVDDIQILSKDRTILGLEIHVGKNRIVRRIFAHLGYEVVALDRVTYAGLTKKDL
SRGKWRFLTEKEVINLKFMKK