Protein Info for Echvi_0686 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF00497: SBP_bac_3" amino acids 49 to 264 (216 residues), 56 bits, see alignment E=3.7e-19 PF01464: SLT" amino acids 292 to 398 (107 residues), 65.3 bits, see alignment E=3.7e-22

Best Hits

KEGG orthology group: None (inferred from 40% identity to plt:Plut_1004)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVB0 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Echvi_0686 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MLVMCLLAFLLGCGEEIQKKKKAPPYWESPVQLDLEGIKKRGFIRAVVDNSSTSYYIYRG
RRMGYEYELLRNLAKQLDVQLRLIVNEDIEKAYQLLNKGKADIVAINLVVNEDRKKYGSF
TSKLNLLSSVLVQNRKKEVLDSLQQLDQKTVHVRKSAVYKDQLLQLEDSLQIDIDIVEAP
KNSDELVDEVVRENIDFTLVDEDLALVNSTYYSEINIDLQINSPSPVAWLVRKNAPNLLA
AVNDWIEKGTQSTYFAILYGKYFLNKKNSYYRNKSPFSSISGDQISKYDEIIKEGADYLG
WDWRLLASLVYKESRFNTEATSYAGAKGLLQLMPVTLERFGVDNPNDPSQSLMGGVKYLK
YLDKFWLERVPETNERIKFILASYNVGHGHVNDAWRLALKFGKDTRTWSNVAYYLERKSQ
PKYYRDPVVRSGYAKGHLAVAYVRDILSIYESYRILVDPYPREIEDKTLAKK