Protein Info for Echvi_0685 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Response regulator of the LytR/AlgR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00072: Response_reg" amino acids 4 to 111 (108 residues), 70.6 bits, see alignment E=1.2e-23 PF04397: LytTR" amino acids 154 to 244 (91 residues), 67.3 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: K02477, two-component system, LytT family, response regulator (inferred from 39% identity to fte:Fluta_4056)

Predicted SEED Role

"Autolysis response regulater LytR" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUI2 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Echvi_0685 Response regulator of the LytR/AlgR family (Echinicola vietnamensis KMM 6221, DSM 17526)
MKVGIIDDEVHCVESLVLELMQFKEEVEIVFSTSKVEEALEALSTSSIDLMFLDVEMPRI
NGFELLDMIDEVYFEVVFTTAYSQYALKAFQYKAFDYLLKPIGHHELAEVLKKYKGYHQH
LKKEREVDLMEFISSLKKDNIIKSKIAVPVSEGLEFIKVDEIIYAQSQNNYTILHLHDNT
TLLFSKTLKEVERTLKKYFFIRIHQSYLINPNYMKKYFRHDGGGVQMENGKSLPISQRKK
EEIITLFEAIAKNKSL