Protein Info for Echvi_0669 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 TIGR02063: ribonuclease R" amino acids 23 to 719 (697 residues), 765.3 bits, see alignment E=6.4e-234 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 88 to 718 (631 residues), 529.8 bits, see alignment E=9.6e-163 PF08206: OB_RNB" amino acids 92 to 153 (62 residues), 35.3 bits, see alignment 1.8e-12 amino acids 165 to 221 (57 residues), 27.6 bits, see alignment 4.6e-10 PF17849: OB_Dis3" amino acids 169 to 240 (72 residues), 44 bits, see alignment E=4.7e-15 PF17876: CSD2" amino acids 173 to 247 (75 residues), 95.5 bits, see alignment E=4e-31 PF00773: RNB" amino acids 269 to 594 (326 residues), 392.6 bits, see alignment E=3.9e-121 PF00575: S1" amino acids 638 to 718 (81 residues), 32.7 bits, see alignment E=2e-11

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 61% identity to mtt:Ftrac_1053)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW13 at UniProt or InterPro

Protein Sequence (724 amino acids)

>Echvi_0669 ribonuclease R (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKRPRKQRKGKGKADKINNAAQLAERILHFLDSHYGEEYSLKQIIRKLNIRDKITKGSV
EPVLHKLVAAGSVSKNPRNHFSSTKTPDFIEGTVDFVNPRFAFIVPDKKGEGEEDILVKA
RDLKNALDDDKVRVMVNPPKHAGQKREGRVLEVVKRAREEFVGRVEISPRFAFVVSDFKK
MHHDIFIRKSDLNGAEHNQKVVVKITEWRDEDKNPTGKVLQVLGEAGEHEVEIHSIMAEF
GLPFEYPDEIVQEAEAISDKISKSDIKSRKDFRGVTTFTIDPADAKDFDDAISYQRLPNG
NIEMGVHIADVTHYVKPNTPLEKEAYDRATSVYLVDRTIPMLPERLSNGLCSLRPHEDKL
TFSCVFELDEDGQVLKHWIGRTIIHSDRRFAYEEAQENIDQQEGDFYSELTLLNNLAKKI
RKRRFQQGAINFETVEVKFKLDDKGTPLGLMVKERKDIHKMIEEFMLLANKAVAEFVFNK
NKGDDTFVYRIHDHPDLERLETFANFAKKFGHEVSITEATRVSATLNKLMGEIEGKPEQN
LLEQLAIRSMAKARYTTEPKGHFGLAFKHYTHFTSPIRRYPDMMVHRLLQHYLDGGKSAD
KEAWEDKCIHSSEREKRAADAERASIKYKQVEYMALAEDKAYDGIISGVTEWGIFVEITE
TKCEGMIRLQDLEDDYYEFDEKNMRLIGAKNKKMITLGDQVRVRVVNTDIDRRTIDLEFA
DDND