Protein Info for Echvi_0658 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 1 to 182 (182 residues), 146.3 bits, see alignment E=4.7e-47 PF00117: GATase" amino acids 3 to 182 (180 residues), 159.1 bits, see alignment E=1e-50 PF07722: Peptidase_C26" amino acids 66 to 168 (103 residues), 25.7 bits, see alignment E=9.4e-10

Best Hits

Swiss-Prot: 39% identical to PHNB_PSEAE: Anthranilate synthase component 2, pyocyanine specific (phnB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01664, para-aminobenzoate synthetase component II [EC: 2.6.1.85] (inferred from 44% identity to mtt:Ftrac_1781)

MetaCyc: 39% identical to PhnB anthranilate synthase subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 4.1.3.27

Use Curated BLAST to search for 2.6.1.85 or 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW02 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Echvi_0658 glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MLLLIDNFDSFSHILADYFRQAGFDLHIVRNDTPLAVLMEGKYEGLVLSPGPETPAKAGN
LQEIFEYFHDKLPVLGVCLGHQCIGTFFGAKLVTGARPVHGKVYSVTKRLDHPMLNGLPE
RFLVTRYHSLELKDLPDCLQPLLYTEQGALMAMVHQTLPIVGIQYHPEAYLSEYGLQVIQ
NWGKCYVRDGQSRNEG