Protein Info for Echvi_0658 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 1 to 182 (182 residues), 146.3 bits, E=4.7e-47
• PF00117: GATase
  • amino acids 3 to 182 (180 residues), 159.1 bits, E=1e-50
• PF07722: Peptidase_C26
  • amino acids 66 to 168 (103 residues), 25.7 bits, E=9.4e-10

Best Hits

Swiss-Prot: 39% identical to PHNB_PSEAE: Anthranilate synthase component 2, pyocyanine specific (phnB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01664, para-aminobenzoate synthetase component II [EC: 2.6.1.85] (inferred from 44% identity to mtt:Ftrac_1781)

MetaCyc: 39% identical to PhnB anthranilate synthase subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (12/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (10/10 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Folate biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 4.1.3.27

Use Curated BLAST to search for 2.6.1.85 or 4.1.3.27

Sequence Analysis Tools

See L0FW02 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Echvi_0658 glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MLLLIDNFDSFSHILADYFRQAGFDLHIVRNDTPLAVLMEGKYEGLVLSPGPETPAKAGN
LQEIFEYFHDKLPVLGVCLGHQCIGTFFGAKLVTGARPVHGKVYSVTKRLDHPMLNGLPE
RFLVTRYHSLELKDLPDCLQPLLYTEQGALMAMVHQTLPIVGIQYHPEAYLSEYGLQVIQ
NWGKCYVRDGQSRNEG