Protein Info for Echvi_0654 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: undecaprenyl diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 10 to 237 (228 residues), 278.8 bits, see alignment E=1.4e-87 PF01255: Prenyltransf" amino acids 17 to 237 (221 residues), 279.1 bits, see alignment E=1.2e-87

Best Hits

Swiss-Prot: 55% identical to ISPT_CALS4: Isoprenyl transferase (uppS) from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 60% identity to psn:Pedsa_1956)

MetaCyc: 45% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUF1 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Echvi_0654 undecaprenyl diphosphate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKEAIDKERIPKHIAVIMDGNGRWAQGKGAKRVFGHRNAITAVRETITGANDLGVAYLTL
YTFSTENWSRPKLEVKAIMELLVKTLTDQVPNLMKDNVKLTLIGDMGMLPPRSRAKLSEA
IEETSRNTGLTLILALSYSGRWEITNTVKDIAKKVADNEIDVEEITEDMITSHLLTKDYP
DPELLIRTSGELRISNFLLWQLAYTELYFTEVLWPDFRKEHLLEAVADYQRRERRFGKTG
AQIKS