Protein Info for Echvi_0647 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ferrochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00109: ferrochelatase" amino acids 3 to 203 (201 residues), 166.9 bits, see alignment E=4e-53 PF00762: Ferrochelatase" amino acids 6 to 342 (337 residues), 344.8 bits, see alignment E=4.3e-107

Best Hits

Swiss-Prot: 49% identical to HEMH_PARUW: Ferrochelatase (hemH) from Protochlamydia amoebophila (strain UWE25)

KEGG orthology group: K01772, ferrochelatase [EC: 4.99.1.1] (inferred from 59% identity to mtt:Ftrac_2597)

Predicted SEED Role

"Ferrochelatase, protoheme ferro-lyase (EC 4.99.1.1)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.99.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW79 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Echvi_0647 ferrochelatase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKQAKTGVLLVNLGTPDSTAVPHVRKYLREFLMDGRVIDIPFLSRWLLVNCIIAPFRAP
KSAAEYRKLWTDRGSPLLYHTEDLKDKLIGKLDGEQYQVEMAMRYQSPSIEQGLAALQKG
RVKKIIVIPLFPQYASATNGSVIEKVMEVVKEWQVIPAISFVPKFVDHPLYLQAWKDIAA
DFIQKEEYDAYLFSYHGIPERQIHKASCEGYCQLNDKCCARQTPSNQYCYRAQCFYNTRL
LTEKLGLPSDKVHTAFQSRLGKDPWIQPYTEDTIRQLAQNGAKKVLAFSPAFVADCLETT
VEVGEEYKEVFEEEGGQQWDLVPCLNAHDTWVECVKALVMEQDGARE