Protein Info for Echvi_0631 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phenylalanyl-tRNA synthetase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF02912: Phe_tRNA-synt_N" amino acids 20 to 82 (63 residues), 61.8 bits, see alignment E=5e-21 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 41 to 339 (299 residues), 325.8 bits, see alignment E=1.5e-101 PF01409: tRNA-synt_2d" amino acids 90 to 338 (249 residues), 340 bits, see alignment E=8.1e-106

Best Hits

Swiss-Prot: 70% identical to SYFA_CYTH3: Phenylalanine--tRNA ligase alpha subunit (pheS) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 72% identity to mtt:Ftrac_2390)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FSK7 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Echvi_0631 phenylalanyl-tRNA synthetase, alpha subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MHQDKIEALKIEIAGAEASNPEELEAFRMRYISKKSVVAALFAEMKNVPNDQKKAYGQLV
NSVKQAAEEKFKALIDKVNEGERTSKSAAIDLTLPATNQPVGGIHPLTATRQRIIEIFER
IGFNLSEGPEIEDDWHNFTALNFPENHPAREMQDTFFIEKNPDIALRTHTSSVQVRVMEN
QKPPIRTLSPGRVFRNEAISARAHCIFHQVEGLYVDENVGFADLKQTLYHFAKEMFGKET
KVRFRPSYFPFTEPSAEIDISCLLCGGEGCNVCKGTGWVEIGGSGMVDPNVLKNCGIDPE
KYTGFAFGMGIERIAMLKYQIKDLRLFTENDIRFLKQFKPLL