Protein Info for Echvi_0626 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 140 to 162 (23 residues), see Phobius details amino acids 191 to 218 (28 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details PF14093: DUF4271" amino acids 142 to 353 (212 residues), 86.5 bits, see alignment E=1.2e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FSK1 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Echvi_0626 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MVLFMGTLQAQVLENYNPKIVIEHKYELVPSPVMAKVSLNLKDYPMASFQLEFPEQAAVF
LGEKLWLYASSDTSFIIPIAQLKAAIGENAKSIPMRVYKKGVADGEVSIKKGVFTQGEPV
KEGKDAAVEQLREKDPVKDFLILAFVVVLALVALFKVTYPMVFQSALRPVSLFQEEFSDS
SGGMKLFSSDVIFYMLVFSMLMSLFAFSFLHFAGIGLLSEYFGEGLNALLLIWLSGAMIF
MVMSFLKYLWIKIFAMVYHLDKIDFSQFFYMVKSLMLVLLILYVVIMGFYLQGYTAMDEM
MNYAICAFLVVYLVGIFRLFYLMLKKVPFKSYHLFSYLCSSELVPFLVIVKLIIG