Protein Info for Echvi_0623 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: gliding motility-associated lipoprotein GldK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR03529: gliding motility-associated lipoprotein GldK" amino acids 11 to 353 (343 residues), 609.4 bits, see alignment E=9.7e-188 PF03781: FGE-sulfatase" amino acids 59 to 344 (286 residues), 180.5 bits, see alignment E=2.5e-57

Best Hits

Predicted SEED Role

"GldJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVW0 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Echvi_0623 gliding motility-associated lipoprotein GldK (Echinicola vietnamensis KMM 6221, DSM 17526)
MYKKMNSRFLTGVVMLLSMALLQGCGLFGSKGSASEKANRSGEVTGVPDRSGWQQTLPHE
MVPVKAGTFWMGQADEDIAVSKSSLNKQVTISEFYMDKYEVSNNKYRQFLEAVRMGELAL
STPTTLKDPPQFNIDELVPDTTVWSQSFTHHYGDPLMEYYFEHPAFDDYPVVGISWEQAK
KFCEWKTYHMNANDKSEYDMPRFRLPSEAEWEYAAKGGKEIAKYPWGGPYLKNRRGCLMA
NFKPGRGNYIDDGFAYTAPVDAYAPNNFGIYNMAGNVSEWVEDAYNPAGSALTWDLDPKY
EDENESRKVVRGGSWKDIAHYLETSTRTYEYQDVKTAHIGFRTVMTFIGRSGSMDVRATR
RR