Protein Info for Echvi_0619 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: excinuclease ABC, C subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 TIGR00194: excinuclease ABC subunit C" amino acids 10 to 578 (569 residues), 533.8 bits, see alignment E=2.9e-164 PF01541: GIY-YIG" amino acids 19 to 94 (76 residues), 39 bits, see alignment E=2.4e-13 PF22920: UvrC_RNaseH" amino acids 257 to 358 (102 residues), 47.4 bits, see alignment E=5.1e-16 PF08459: UvrC_RNaseH_dom" amino acids 380 to 531 (152 residues), 194 bits, see alignment E=4.8e-61 PF14520: HHH_5" amino acids 546 to 596 (51 residues), 43 bits, see alignment 1.6e-14 PF12826: HHH_2" amino acids 550 to 598 (49 residues), 29.8 bits, see alignment 1.7e-10

Best Hits

Swiss-Prot: 54% identical to UVRC_CYTH3: UvrABC system protein C (uvrC) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 64% identity to mtt:Ftrac_2560)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUC0 at UniProt or InterPro

Protein Sequence (600 amino acids)

>Echvi_0619 excinuclease ABC, C subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MQSPSYSPEEYQKLPDVPGVYKYYNEEDKLIYVGKAKSLKKRVASYFVKSTGLNLKTRRM
VKEIRRIEFTIVNSEFDALLLENNLIKKNQPRYNILLKDDKTYPYLLLTKEHFPQLYPTR
KLIPSRGTYFGPFASVKAMNNILELIRSLFTIRTCKLDLNPYKIAEQKYKVCLEYHIGNC
LGPCEGLQGEPDYLKDIDQAKHILKGNLGIPKAYFKSKMQEAAEDLAFEKAQRFKDKLDL
LEKYQAKSLVTNPHVTDLDVFAIVSADKFAFVNYLNIKNGAINITKTVELKKKLDETEQE
LLLTAIFRLKDQFQSDAKEILSNIDLDDPIEGLHLTVPKIGDKRKLVELALKNAMYYKKE
KALLSGKAKEKKNRVILQLQKDLSLKEAPDHIECFDNSNIQGAYPVASMVCFMDGKPAKK
EYRHFHVKTVEGPDDFASMTEIVGRRYKRLLKENKPLPKLIVIDGGKGQLSAAVEALKSL
DIYGQVPIIGIAKKLEEIYFPGDSFPLHIDKKSESLRLIQRVRDEAHRFAITFHRDIRSK
DSFKTALDTIEGIGPSTSNKLLKHYKSLKKIREASEEDLAQIIGKDKASRIINFIKQESR