Protein Info for Echvi_0608 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: proton translocating ATP synthase, F1 alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 TIGR00962: ATP synthase F1, alpha subunit" amino acids 4 to 504 (501 residues), 765.1 bits, see alignment E=1.7e-234 PF02874: ATP-synt_ab_N" amino acids 27 to 92 (66 residues), 66 bits, see alignment E=5.4e-22 PF00006: ATP-synt_ab" amino acids 151 to 389 (239 residues), 253.6 bits, see alignment E=2.3e-79 PF00306: ATP-synt_ab_C" amino acids 396 to 507 (112 residues), 138.6 bits, see alignment E=2.2e-44

Best Hits

Swiss-Prot: 80% identical to ATPA_CYTH3: ATP synthase subunit alpha (atpA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02111, F-type H+-transporting ATPase subunit alpha [EC: 3.6.3.14] (inferred from 83% identity to mtt:Ftrac_2571)

Predicted SEED Role

"ATP synthase alpha chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVU5 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Echvi_0608 proton translocating ATP synthase, F1 alpha subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MAEVRPDEVSAILREQLSGAKTEAELEEVGTVLQVGDGVARIYGLSQAQSGELLEFENGL
KAMVLNLEEDNVGAVLFGDSKEVKEGDTVKRTKQIASIKAGEGMLGRVVDTLGQPIDGKG
PIEGDLYDMPLERKAPGVIYRQPVNEPLQTGIKSIDAMIPIGRGQRELIIGDRQTGKTAV
AIDTILNQKEFYDKGEPVFCIYVAIGQKASTVAGVVAALEKGGALPYTVVVSAAASEPAP
MQFFAPFTGAAIGEFFRDTGRPALVVYDDLSKQAVAYREVSLLLRRPPGREAYPGDVFYL
HSRLLERAAKINSSDTIAKEMNDLPESLKPLVKGGGSLTALPIIETQAGDVSAYIPTNVI
SITDGQIFLETNLFNSGIRPAINVGISVSRVGGSAQIKSMKKVSGTLKLDQAQFRELEAF
AKFGSDLDATTKRTIERGRRNQEILKQAQYSPVKVELQAAIIYASTKGLMDSVPVERARE
FEKEFYTLLTSQYQEAITALAKGDLDTAGKLLEKAAKELTPKYAK