Protein Info for Echvi_0593 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Adenylate kinase and related kinases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13238: AAA_18
  • amino acids 4 to 143 (140 residues), 41.1 bits, E=5e-14
• PF13671: AAA_33
  • amino acids 4 to 149 (146 residues), 41.4 bits, E=3.5e-14
• PF00406: ADK
  • amino acids 6 to 165 (160 residues), 182.3 bits, E=1.3e-57
• PF13207: AAA_17
  • amino acids 7 to 143 (137 residues), 122 bits, E=4.6e-39

Best Hits

Swiss-Prot: 54% identical to KAD_FLAPJ: Adenylate kinase (adk) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 76% identity to mtt:Ftrac_1938)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• purine deoxyribonucleosides salvage (6/6 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

See L0FVT1 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Echvi_0593 Adenylate kinase and related kinases (Echinicola vietnamensis KMM 6221, DSM 17526)
MLNIVLFGPPGAGKGTQSEKLIAKYELEHISTGDLFRKHLGEGTDLGKLARKYMDEGRLV
PDEVVIGMVDDKIKTTKGAKGFILDGFPRTVAQAEALDKLLEEKDMRISGMIALEVPEEE
LKERIRHRGKTSGRVDDQDEEKINTRIKVYKEETLPVASYYEKQGKLSTVHGVGGIDEIF
GKISAVIDQY