Protein Info for Echvi_0513 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 114 to 177 (64 residues), 74.7 bits, see alignment E=5e-25 PF21082: MS_channel_3rd" amino acids 186 to 271 (86 residues), 27.5 bits, see alignment E=3.5e-10

Best Hits

KEGG orthology group: None (inferred from 61% identity to zpr:ZPR_2606)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU16 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Echvi_0513 Small-conductance mechanosensitive channel (Echinicola vietnamensis KMM 6221, DSM 17526)
MEQGHLQTILSSLRESWQNFLESVPSIILGILVITIGYIIARRIGEITRSKIRNRSSDPL
MSRFLGNTVKICFFLLTIIYAMNIAGLGEITTFLLSSIGASAIIIGFAFKDIGENFISGI
ILAFNRPFNVNDTVEVGDLFGKIKSLEFRYTKLKTFDGKDVYIPNSDVLKKPVINYTEDG
FFRWDFIVGIAYEDNIEQAKKVILETVNSHPSIIQDAVHENYVAEDQLATSTVNLKVFFW
VDTYEFRREAVMVKGEVIKQVKEALEANGFSMPSDIVELKLYSSQKDLPVKLQSPNGQ