Protein Info for Echvi_0503 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4)
Rationale: Specifically important for utilizing L-Arabinose. Automated validation from mutant phenotype: the predicted function (RIBULPEPIM-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00596: Aldolase_II
  • amino acids 10 to 199 (190 residues), 152.8 bits, E=4.9e-49

Best Hits

Swiss-Prot: 53% identical to ARAD_GEOSE: L-ribulose-5-phosphate 4-epimerase (araD) from Geobacillus stearothermophilus

KEGG orthology group: K01786, L-ribulose-5-phosphate 4-epimerase [EC: 5.1.3.4] (inferred from 80% identity to fjo:Fjoh_1120)

MetaCyc: 51% identical to L-ribulose-5-phosphate 4-epimerase AraD (Escherichia coli K-12 substr. MG1655)
L-ribulose-5-phosphate 4-epimerase. [EC: 5.1.3.4]

Predicted SEED Role

"L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4)" in subsystem L-Arabinose utilization or L-ascorbate utilization (and related gene clusters) (EC 5.1.3.4)

MetaCyc Pathways

• L-arabinose degradation I (4/4 steps found)
• L-ascorbate degradation II (bacterial, aerobic) (4/7 steps found)
• L-lyxose degradation (1/4 steps found)
• L-ascorbate degradation I (bacterial, anaerobic) (1/5 steps found)
• superpathway of pentose and pentitol degradation (11/42 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.4

Sequence Analysis Tools

See L0FU07 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Echvi_0503 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKFLELKRECYEANMQLPALDLVVYTFGNVSAVDRKEGVFAIKPSGVAYEALTPEDIVI
CDFDAKIVEGEMRPSSDTKTHAYLYKEWENIGGIVHTHSLYGVSWAQAQMDVPIFGTTHA
DHLTKDIPCAPPMADELIEGDYEHMTGKQILDCFAEKGLDYEEVEMILVGSHGPFTWGKT
AAKAVYNSKVLEEVAKMAYLTLQINPNAPRLKDALIKKHYERKHGKDAYYGQGC