Protein Info for Echvi_0487 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Highly conserved protein containing a thioredoxin domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07470: Glyco_hydro_88" amino acids 56 to 273 (218 residues), 29.4 bits, see alignment E=2.1e-11

Best Hits

KEGG orthology group: None (inferred from 67% identity to phe:Phep_4097)

Predicted SEED Role

"Glucuronyl hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVH9 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Echvi_0487 Highly conserved protein containing a thioredoxin domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKRWYFLALMAGLMATGCGNGKAENEEAKTAAPAENGLAKQISSTLDRAAEQYKYMMTR
LPEGEFPKTYHPDTDTFEGSGSGWWCSGFYPGTLLYLDEYHPDETLHNEAMRSLELLKKE
QHNTSTHDLGFMMYCSFGNAFRMDPEPEYKEVLIQSAKSLSTRFSEKVGAIKSWDSRKGD
FLVIIDNMMNLELLFWATAATGDSTYYDIAIKHADTTIANHFREDNSSYHVINYHPETGE
VQRKRTAQGYADESAWARGQAWGLYGYTVMYRVTKDQKYLDQAVAIAEFVLNHPNLPEDK
IPYWDFDAPNIPNELRDSSAGAIMASALLELSQYVDAEKGKSYYEDAATMLKTLTTDEYI
AEKGTNGGFLLKHGVGHIPENSEVDVPLTYGDYYLVEAMLRYLD