Protein Info for Echvi_0409 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 278 (266 residues), 163.4 bits, see alignment E=3.6e-52

Best Hits

KEGG orthology group: None (inferred from 64% identity to sli:Slin_4383)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTS2 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Echvi_0409 Sugar phosphate permease (Echinicola vietnamensis KMM 6221, DSM 17526)
MKGKIRWFILALVFVATGLSFLDRQVLSMTIIKIQEELNITDVQYGVINTGFLISYALMF
TIAGRLIDKIGAKLGLTLSVAIWSIASVLHGVMSGFYHLLMFRFLLGVGEGGCFPGAAKT
VYEWFGKRERALANGIAIGGSAIGAVVAPPLTIIISGNYGWRWAFIIPGVFGVLWVLVWG
TISWRKKRADKQQREVNVPLKRAEGISFLEIIKNRSARVFVLMRLLLDPVFYFLMFWVPK
YLSEERGLSFDRIGELFWIPFMALGISNIIGGWISDTLIAKNLSVNAARKWVMGIAALLT
LIAPFITRVSSVELAVGFMAIMMLAHGFWITNYVTAISDIFGKYATSTVVGLSGTAGAIA
GMLVNPIIGMVVQKYSYAPLWWVAGIMYPLAFIIMVMFIPNLNPITVRHSIKVKA