Protein Info for Echvi_0405 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: L-arabinose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF11762: Arabinose_Iso_C" amino acids 352 to 491 (140 residues), 36.9 bits, see alignment E=3e-13 PF02952: Fucose_iso_C" amino acids 396 to 493 (98 residues), 37 bits, see alignment E=2.6e-13

Best Hits

KEGG orthology group: None (inferred from 76% identity to sli:Slin_4382)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUJ2 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Echvi_0405 L-arabinose isomerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNELLKREQVVMNGQVVRREETVPRIGVFGVGYFKYWEQFDGLLEDLLEKQNVFVEKLKR
NKVDTIEFGLVDDAKSAYDLVPKLKAANLDLIFCDMLTYATSSTFGVIIKNLDVPIVLVA
LQPDKAMDYSKASTYMQLYNDDVCSLPEFTGVAVRMGKKIPDVIIGTLHDDPQSEQEIRE
YCNIARVLHGLKTTRIGHIGHPIEAMLDMHSDSTMLTAHFGVHVVQCEPHEIVSKYQKEV
NEREIKSEEQRILAFFDTPDPVSDPISEKLKPEDLEVAARVSVALKKFVEEKELDGLAYY
YNGEENSDTQLVMSNLIVGNSLLTSAGFPMCGESDLKCCLAMFIMDRLGIGGSFAEFHPV
DFKENFILVGHDGPHNISIAEGKPVLRSLKKYHGKPGFGAGVEFKIKEGPITMLSITSTY
EGKFKFVIAEGESVEGPIPPTGNTNTRGYFKPDVRTFLTKWVKEGPTHHFALGVGHHAQT
IRKIGEYLNIEAVIVE