Protein Info for Echvi_0382 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Type I restriction-modification system methyltransferase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF12161: HsdM_N" amino acids 5 to 134 (130 residues), 37 bits, see alignment E=5.5e-13 PF02384: N6_Mtase" amino acids 144 to 448 (305 residues), 239.7 bits, see alignment E=5e-75

Best Hits

Swiss-Prot: 49% identical to T1ME_ECOLX: Type I restriction enzyme EcoEI M protein (hsdM) from Escherichia coli

KEGG orthology group: K03427, type I restriction enzyme M protein [EC: 2.1.1.72] (inferred from 68% identity to gpb:HDN1F_15160)

Predicted SEED Role

"Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72)" in subsystem Restriction-Modification System (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV88 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Echvi_0382 Type I restriction-modification system methyltransferase subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MANLKGILDSIRKIMWQDTGLNGDAQRIEQLGWMLFLKIFSDKDKELEVIKDDYESPIPA
EFHWDEWAGDDEGITGDELQAFVDQKLFPTLRNLKVGMSEDLANQRALLVREVFEGNNNY
MKSGINLRKVLNKLNEIDFNIAKDRHAFGELYETILKELQSAGKSGEFYTPRAITEFICE
MMNPQLGEKILDPSCGTGGYLTAAIEHLKSQANSVAERESIAKNVFGWEYKPLPYLLATT
NLILHDMEVPNITFRDSLDQPLSNYTEKNRVNVILANPPFGGIVANNNENNFPQNFKTKE
SADLFLVLMVHLLKQGGRAGIVLPDGSLTGDGVKQRVREKLLTDCNLHTIIRLPNSVFKP
YATVATNLLFFTKGEPTKEIWYYEHRLPEGQKSYSKTKPLQVKEFDPIKKWWNDRQESEV
SWKVDIQTVKDRNYDLDIKNPTKQEEEIEHSSSELMTMLDDSFDRSHELLSHIRSAIK