Protein Info for Echvi_0373 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: acyl-CoA thioester hydrolase, YbgC/YbaW family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family
  • amino acids 8 to 114 (107 residues), 95.4 bits, E=1.4e-31
• PF13279: 4HBT_2
  • amino acids 10 to 128 (119 residues), 47.3 bits, E=2.7e-16
• PF03061: 4HBT
  • amino acids 18 to 101 (84 residues), 46.7 bits, E=3.2e-16

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 60% identity to shg:Sph21_3071)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See L0FUG2 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Echvi_0373 acyl-CoA thioester hydrolase, YbgC/YbaW family (Echinicola vietnamensis KMM 6221, DSM 17526)
MFTAETQVRVRYAETDQMGYVYYGNYAMYFEVARVESLRQIGFSYKDMEDQGIMMPVLES
YSKYIRPGRYDELLTIKTTIKEMPGVKIRFDYEITNEGQELIHKGHTVLTFLKKDDHRPC
RPPANLLDLLNAYF