Protein Info for Echvi_0366 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein conserved in bacteria containing a pentein-type domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF19420: DDAH_eukar" amino acids 13 to 306 (294 residues), 357 bits, see alignment E=3.5e-111

Best Hits

KEGG orthology group: None (inferred from 47% identity to mtt:Ftrac_3242)

MetaCyc: 47% identical to citrullinase (Pseudomonas fluorescens)
Citrullinase. [EC: 3.5.1.20]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV74 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Echvi_0366 Uncharacterized protein conserved in bacteria containing a pentein-type domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MCAQTTSTILMVRPAAFGFNPETALDNSYQQEDARSTAEIQQVAEQEFDDVVALLRKKGV
RVIVAQDSPLPVKPDAVFPNNWFSTHEDGRLLWYPMLSPVRRKERRKDLVDILGVEGFRV
DELVDFTFFEDAQQFLESTGSMVLDREHKIAYACLSERTHPEPLHYFERLMDYQVVSFRA
VHSSSKIPVYHTNVMMHVGSQLAVVCLDSIVGKSVKQWVKESLEGSGKKVVPITIPQKFA
FAGNMLEVDGENGKKITVMSETAYQSLKQGQRQVIEKYTEVVVAKIPTIEKVGGGGVRCM
MAEIFLPKQTGQHP