Protein Info for Echvi_0351 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted transcription factor, homolog of eukaryotic MBF1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 93 to 116 (24 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 223 to 251 (29 residues), see Phobius details PF13560: HTH_31" amino acids 13 to 66 (54 residues), 32 bits, see alignment E=1.3e-11 PF01381: HTH_3" amino acids 18 to 68 (51 residues), 37.2 bits, see alignment 2.4e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV60 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Echvi_0351 Predicted transcription factor, homolog of eukaryotic MBF1 (Echinicola vietnamensis KMM 6221, DSM 17526)
MVNQTLLTMKQPELGKLIQQHRLSKGMTQEELVERCNINVRTIQRIEAGEVTPRAFTVKT
IMEVLQIQMPTKDPEMPRSAVGSIFSTVDRRQLWWTGIAGVIYFLVSSYEVFWNIVLMAD
AGMQQPEYFTLLKAVVLLSYAAFAYGFYLIGQRTNNKVLQFGVVFLILVNAGIIGADIYS
GKVVGAEDMWVGVFEVVAFGVSLVPFSIGLVQSKRSFGQHYQIVGVLGLITAVMFVTVIF
TLLGTLTWAVFDIACIYLLFRQAQGVEMPKQEMESGPFSMR