Protein Info for Echvi_0346 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF00583: Acetyltransf_1" amino acids 21 to 125 (105 residues), 52.1 bits, see alignment E=1.6e-17 PF13673: Acetyltransf_10" amino acids 28 to 145 (118 residues), 64.7 bits, see alignment E=1.7e-21 PF13508: Acetyltransf_7" amino acids 45 to 127 (83 residues), 49.5 bits, see alignment E=9.4e-17 PF08445: FR47" amino acids 60 to 128 (69 residues), 29.5 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: None (inferred from 58% identity to mtt:Ftrac_1368)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTL5 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Echvi_0346 Predicted acyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKITVRKVTDKSTLDKVFGIRQEVFVVGQQVPPAEEYDEFEETSIHFLALLDDVPAGTA
RWRFTDKGIKLERFAVLEEARGKGVGQALVKATLEDIAASEGTTGQCIYLHAQLHAVPLY
AKFGFEKVGDIFSECDILHYKMERYL