Protein Info for Echvi_0339 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Tetratricopeptide repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF13432: TPR_16" amino acids 16 to 75 (60 residues), 41.7 bits, see alignment E=7.9e-14 amino acids 118 to 179 (62 residues), 23.1 bits, see alignment E=5.2e-08 PF13174: TPR_6" amino acids 24 to 45 (22 residues), 12.8 bits, see alignment (E = 9.9e-05) amino acids 53 to 76 (24 residues), 13.5 bits, see alignment (E = 5.6e-05) PF13181: TPR_8" amino acids 24 to 45 (22 residues), 12.9 bits, see alignment (E = 6.7e-05) amino acids 82 to 112 (31 residues), 14 bits, see alignment 2.8e-05 amino acids 115 to 146 (32 residues), 17.1 bits, see alignment 2.9e-06 PF14559: TPR_19" amino acids 26 to 67 (42 residues), 26.8 bits, see alignment 3.2e-09 amino acids 57 to 114 (58 residues), 28.2 bits, see alignment E=1.2e-09 PF13431: TPR_17" amino acids 34 to 66 (33 residues), 24.7 bits, see alignment 1.2e-08 PF07719: TPR_2" amino acids 47 to 77 (31 residues), 24.6 bits, see alignment 1.1e-08 amino acids 115 to 146 (32 residues), 23.5 bits, see alignment 2.5e-08 PF13414: TPR_11" amino acids 55 to 93 (39 residues), 34.6 bits, see alignment 7.3e-12 amino acids 87 to 125 (39 residues), 34.3 bits, see alignment 9e-12 PF00515: TPR_1" amino acids 115 to 146 (32 residues), 33.1 bits, see alignment 2e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVE7 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Echvi_0339 Tetratricopeptide repeat. (Echinicola vietnamensis KMM 6221, DSM 17526)
MAVLLWSCSPSEQELYDAGIKEMRLEKFNEAITYFDRVIEQNPDHTEAHNAKGVAFFEQG
KWDEAIKHFKVAMEKDSTSYKPYLNLGNAYLEKKAFKDAVINYNMASSLDPNQTDIYYNR
GLALLGMEAYEDAILDFDNALQVDPNQALVHFNRAKALIGNNNPLEAINALKRSVAIDNT
NGAAFYLLGVTEMSALSEKEEGCMHLKTALGLGYADAKEWIDEFCDTESES