Protein Info for Echvi_0338 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Sua5/YciO/YrdC/YwlC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 7 to 200 (194 residues), 177.3 bits, see alignment E=1.1e-56 PF01300: Sua5_yciO_yrdC" amino acids 14 to 189 (176 residues), 190.2 bits, see alignment E=2.4e-60 PF03481: Sua5_C" amino acids 191 to 319 (129 residues), 99.3 bits, see alignment E=2.8e-32

Best Hits

KEGG orthology group: K07566, putative translation factor (inferred from 58% identity to chu:CHU_2418)

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FRT2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Echvi_0338 Sua5/YciO/YrdC/YwlC family protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MTTIGKDIKKAKALLEKGELVGIPTETVYGLAGNALDAAAVSKIFETKNRPSFDPLIVHT
GSIEQISAYTTGIPEELEVLADAFWPGPLTLLLPKKSIVPDLVTSGLDQVAVRVPSHPLT
RELLLSLDFPLAAPSANPFGYISPTCASHVVDQLEGKIDYVLDGGNCEVGLESTIVGVEE
GQITIYRLGGIEVADIKKVVGNVLILPQSSSNPKSPGMLKSHYAPRIPFIVGDLEQLVPH
YLEKNERFGVLSFTKTFEGVPAEHQRVLSAAGDFKEAAQQLFAAMRYLDKQDVSVILSGE
MPERGLGKAVNDRLRRAAAR