Protein Info for Echvi_0331 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07364: DUF1485" amino acids 38 to 320 (283 residues), 346 bits, see alignment E=1.8e-107 PF07171: MlrC_C" amino acids 330 to 500 (171 residues), 194.9 bits, see alignment E=1.4e-61

Best Hits

KEGG orthology group: None (inferred from 74% identity to dfe:Dfer_1346)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTK2 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Echvi_0331 Uncharacterized conserved protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKSFTLLLTSSLLSFLALFSSCSSTSEQQAEKVNLPRIAIAGLAIESSTFSPAVTEAPA
FHAKTGEEIYDNYPFMAAGSENRQRAEWVPTLTGKAIPGGIVSREAYESLMEKTLKMLKE
NGPYDGLFFDIHGAMSVQGLDDPEGDMITRIREVIGKEPIISTSMDLHGNVSWRLAKHSD
LITCYRMAPHEDALESKKRAMDNLLARIESGKGKPAYKAYVPVPILLPGEKTSTRVEPGK
SLYAAVAPAANQTGIVDAAIWIGYAWADEPRNHGVVMVTGDDEEKVTATAEELAEQFWAV
RDEFEFVAPTATLTEALDSAIASEEQPFMISDSGDNPTAGGAGDVTWTLRQILNRPEFKD
ANGPSVIYASIPGPKLVEAAEKVGVGGHVEAPVGAAVDDRYEGPIMLKGSVESIKKGDRH
AETEVVVKCGSVNVIVTKKRKPYHHEADFTALGLQPKQTDIVVVKIGYLVPELYDMRADW
LLALTPGGVDQDLMRLEYERIKRPMFPFDPGMERPDLSAKLVPLSHEE