Protein Info for Echvi_0322 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 14 to 102 (89 residues), 28.1 bits, E=6.4e-10
• PF03446: NAD_binding_2
  • amino acids 14 to 110 (97 residues), 26.1 bits, E=2e-09
• PF01210: NAD_Gly3P_dh_N
  • amino acids 14 to 176 (163 residues), 107.9 bits, E=1.3e-34
• PF07479: NAD_Gly3P_dh_C
  • amino acids 199 to 339 (141 residues), 164.1 bits, E=6e-52
• PF20618: GPD_NAD_C_bact
  • amino acids 259 to 324 (66 residues), 62.1 bits, E=1.4e-20

Best Hits

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 62% identity to mtt:Ftrac_3756)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• phosphatidylglycerol biosynthesis I (4/6 steps found)
• phosphatidylglycerol biosynthesis II (4/6 steps found)
• 1,3-propanediol biosynthesis (engineered) (6/9 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (8/12 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (6/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (8/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See L0FUC1 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Echvi_0322 Glycerol-3-phosphate dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MTLKNSSNNSEKPVGVIGIGSFGTAIANILAEKNNVIVYARKQEIVDEINEQHSAEGREL
NQNITATTDPQSLCETCEVMFPVVSSSGFRDVMKKFAPFLHPYHILIHGTKGLVLNLPEG
RNLDNVSKIHRENIWTMSEVIQNETVVVRVGCLAGPNLAKELAKGQPAATVVASRFNEVI
LEGQRLLRSDRFQVYGNQDIIGVELSGVLKNTIAIASGALAGLGLGENAKGLLISRGMVE
MIHLGNALGGQTQSFVGLAGIGDLVTTCSSTFSRNYTVGFRLAKGETLEAINDSMDEVAE
GINTVRLLKTFLEGTGMRAPITENLYKVLFEGFKVEDALYYLMKYPFNVDIDFL