Protein Info for Echvi_0314 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: UDP-N-acetylmuramyl-tripeptide synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 23 to 481 (459 residues), 496.8 bits, see alignment E=3.5e-153 PF01225: Mur_ligase" amino acids 27 to 97 (71 residues), 40.9 bits, see alignment E=3.2e-14 PF08245: Mur_ligase_M" amino acids 110 to 306 (197 residues), 164.5 bits, see alignment E=4.6e-52 PF02875: Mur_ligase_C" amino acids 328 to 457 (130 residues), 113.5 bits, see alignment E=1.8e-36

Best Hits

Swiss-Prot: 62% identical to MURE_CYTH3: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (murE) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 64% identity to mtt:Ftrac_3289)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVC5 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Echvi_0314 UDP-N-acetylmuramyl-tripeptide synthetase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTLKDILYNVSLTSTTGDMEVAVKDIVFDSRKVEEGDVFVATKGTQVDGHAYIDKAIAS
GAKAIVCEALPGELPKGITYVQVVDSAKALGIMASNFFDHPSAQLKVVAVTGTNGKTTCV
TLLHRLFMELGYMVGMLSTVENKINDEVIAATHTTPDSVAINRLMAKMVAEGCTHCFMEA
SSHAIVQERMAGLQLSGAVFTNISHDHLDYHGTFDEYIKAKKKLFDELPKGAFALVNADD
KRGMVMMQNTKASKRTFGLKYPTDFKAKVLSNTLQGLELDLNGRQAWFRMIGEFNAYNIT
SVLGVALLLGEEEEEVLMQLSSIKGAQGRFDQLHVEGITAIVDYAHTPDALENVLKTIQG
VRTGGEKVITVVGCGGNRDKAKRPVMAKIATDMSDKVVLTSDNPRDEDPMEILRDMETGV
NPVAYKKTVVIADRKEAIKTACVMAEKGDIILVAGKGHETYQEIKGVKHPFDDLKIVKEL
MELIHTK